Novus Biologicals
Manufacturer Code:NBP162384
Catalog # NBP162384
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP4F12(cytochrome P450 family 4 subfamily F polypeptide 12) The peptide sequence was selected from the middle region of CYP4F12. Peptide sequence DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CYPIVF12; CYPIVF12 cytochrome P450 4F12 cytochrome P450 family 4 subfamily F polypeptide 12 cytochrome P450 subfamily IVF polypeptide 12 EC 1.14.14.1 F22329_1; Cytochrome P450 4F12; cytochrome P450, family 4, subfamily F, polypeptide 12; cytochrome P450, subfamily IVF, polypeptide 12
Gene Aliases: CYP4F12; CYPIVF12; F22329_1; UNQ568/PRO1129
UniProt ID: (Human) Q9HCS2
Entrez Gene ID: (Human) 66002
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.