Novus Biologicals
Manufacturer Code:NBP169677
Catalog # NBP169677
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP4B1(cytochrome P450 family 4 subfamily B polypeptide 1) The peptide sequence was selected from the N terminal of CYP4B1. Peptide sequence SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CYPIVB1; CYPIVB1 cytochrome P450 4B1 cytochrome P450 family 4 subfamily B polypeptide 1 cytochrome P450 subfamily IVB polypeptide 1 Cytochrome P450-HP EC 1.14.14.1 microsomal monooxygenase P-450HP; Cytochrome P450 4B1; cytochrome P450, family 4, subfamily B, polypeptide 1; cytochrome P450, subfamily IVB, polypeptide 1; Cytochrome P450-HP; microsomal monooxygenase
Gene Aliases: CYP4B1; CYPIVB1; P-450HP
UniProt ID: (Human) P13584
Entrez Gene ID: (Human) 1580
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.