Novus Biologicals
Manufacturer Code:NBP255469
Catalog # NBP255469
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CYPIIS1; CYPIIS1 cytochrome P450 2S1 cytochrome P450 family member predicted from ESTs cytochrome P450 family 2 subfamily S polypeptide 1 cytochrome P450 subfamily IIS polypeptide 1 cytochrome P540 subfamily IIS polypeptide 1 EC 1.14.14.1; Cytochrome P450 2S1; cytochrome P450, family 2, subfamily S, polypeptide 1; cytochrome P540, subfamily IIS, polypeptide 1; Hydroperoxy icosatetraenoate dehydratase; Thromboxane-A synthase
Gene Aliases: CYP2S1; CYPIIS1; UNQ891/PRO1906
UniProt ID: (Human) Q96SQ9
Entrez Gene ID: (Human) 29785
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.