Novus Biologicals
Manufacturer Code:NBP257213
Catalog # NBP257213
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1,25-@dihydroxyvitamin D3 24-hydroxylase; 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; 24-OHase; 25-dihydroxyvitamin D(3) 24-hydroxylase mitochondrial CP241 CYP24125-alphadihydroxyvitamin D3 24-hydroxylase Cytochrome P450 24A1 cytochrome P450 family 24 subfamily A polypeptide 124-OHase cytochrome P450 subfamily XXIV (vitamin D 24-hydroxylase) Cytochrome P450-CC24 EC 1.14.13.n4 exo-mitochondrial protein MGC126273 MGC126274 P450-CC24 vitamin D 24-hydroxylase Vitamin D(3) 24-hydroxylase; Cytochrome P450 24A1; cytochrome P450, family 24, subfamily A, polypeptide 1; cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase); Cytochrome P450-CC24; exo-mitochondrial protein; vitamin D 24-hydroxylase; vitamin D(3) 24-hydroxylase
Gene Aliases: CP24; CYP24; CYP24A1; HCAI; HCINF1; P450-CC24
UniProt ID: (Human) Q07973
Entrez Gene ID: (Human) 1591
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.