Novus Biologicals
Manufacturer Code:NBP169680
Catalog # NBP169680
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP20A1(cytochrome P450 family 20 subfamily A polypeptide 1) The peptide sequence was selected from the N terminal of CYP20A1. Peptide sequence ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CYP-M cytochrome P450 20A1 cytochrome P450 monooxygenase cytochrome P450 family 20 subfamily A polypeptide 1 EC 1.14 MGC22229; Cytochrome P450 20A1; cytochrome P450 monooxygenase; cytochrome P450, family 20, subfamily A, polypeptide 1
Gene Aliases: CYP-M; CYP20A1; UNQ667/PRO1301
UniProt ID: (Human) Q6UW02
Entrez Gene ID: (Human) 57404
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.