Novus Biologicals
Manufacturer Code:NBP213891
Catalog # NBP213891
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ALDOS; ALDOSCYP11B Aldosterone synthase Aldosterone-synthesizing enzyme CPN2 CYP11BL CYPXIB2 cytochrome P450 11B2 mitochondrial cytochrome P450 family 11 subfamily B polypeptide 2 cytochrome P450 subfamily XIB (steroid 11-beta-hydroxylase) polypeptide 2 Cytochrome P-450Aldo Cytochrome P-450C18 EC 1.14.15 EC 1.14.15.4 EC 1.14.15.5 mitochondrial cytochrome P450 family 11 subfamily B polypeptide 2 P450aldo P450C18 P-450C18 steroid 11-beta/18-hydroxylase steroid 11-beta-monooxygenase Steroid 18-hydroxylase steroid 18-hydroxylase aldosterone synthase P450C18 P450aldo; Aldosterone synthase; Aldosterone-synthesizing enzyme; Corticosterone 18-monooxygenase, CYP11B2; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Cytochrome P450 11B2, mitochondrial; cytochrome P450, family 11, subfamily B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; Steroid 11-beta-hydroxylase, CYP11B2; steroid 11-beta-monooxygenase; steroid 11-beta/18-hydroxylase; Steroid 18-hydroxylase; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo
Gene Aliases: ALDOS; CPN2; CYP11B; CYP11B2; CYP11BL; CYPXIB2; P-450C18; P450aldo; P450C18
UniProt ID: (Human) P19099
Entrez Gene ID: (Human) 1585
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.