Novus Biologicals
Manufacturer Code:NBP154758
Catalog # NBP154758
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP11A1(cytochrome P450 family 11 subfamily A polypeptide 1) The peptide sequence was selected from the N terminal of CYP11A1. Peptide sequence QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cholesterol 20-22 desmolase; Cholesterol desmolase; Cholesterol desmolase cholesterol monooxygenase (side-chain-cleaving) cholesterol side-chain cleavage enzyme mitochondrial CYPXIA1 Cytochrome P450 11A1 Cytochrome P450(scc) cytochrome P450 family 11 subfamily A polypeptide 1 cytochrome P450C11A1 EC 1.14.15 EC 1.14.15.6 steroid 20-22-lyase subfamily XIA (cholesterol side chain cleavage); cholesterol monooxygenase (side-chain cleaving); Cholesterol side-chain cleavage enzyme, mitochondrial; CYPXIA1; Cytochrome P450 11A1; cytochrome P450 family 11 subfamily A polypeptide 1; Cytochrome P450(scc); cytochrome P450, family 11, subfamily A, polypeptide 1; cytochrome P450, subfamily XIA (cholesterol side chain cleavage); cytochrome P450C11A1; steroid 20-22-lyase
Gene Aliases: CYP11A; CYP11A1; CYPXIA1; P450SCC
UniProt ID: (Human) P05108
Entrez Gene ID: (Human) 1583
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.