Novus Biologicals
Manufacturer Code:NBP169701
Catalog # NBP169701
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYB561(cytochrome b-561) The peptide sequence was selected from the middle region of CYB561. Peptide sequence LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cytochrome b-561; Cytochrome b561; cytochrome b561 cytochrome b-561FRRS2 ferric-chelate reductase 2; cytochrome b561 family, member A1; ferric-chelate reductase 2; Transmembrane ascorbate-dependent reductase CYB561
Gene Aliases: CYB561; CYB561A1; FRRS2
UniProt ID: (Human) P49447
Entrez Gene ID: (Human) 1534
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.