Novus Biologicals
Manufacturer Code:NBP231015
Catalog # NBP231015
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSSLTSIFTNTLSEPTDGPVATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGSLALPFPADVQGKDAFTD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3CxxC-type zinc finger protein 5; C2orf85 Chromosome 2 Open Reading Frame 85 CXXC11 CXXC-Type Zinc Finger Protein 11; CXXC finger protein 11; CXXC-type zinc finger protein 11; receptor (chemosensory) transporter protein 5 (putative); Receptor-transporting protein 5; zinc finger, 3CxxC-type 5
Gene Aliases: C2orf85; CXXC11; RTP5; Z3CXXC5
UniProt ID: (Human) Q14D33
Entrez Gene ID: (Human) 285093
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.