Novus Biologicals
Manufacturer Code:NBP238547
Catalog # NBP238547
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C-X-C chemokine receptor type 3; CD183; CD183 CD183 antigen chemokine (C-X-C motif) receptor 3 chemokine (C-X-C) receptor 3 CKR-L2IP-10 receptor CMKAR3 C-X-C chemokine receptor type 3 CXC-R3 CXCR-3 G protein-coupled receptor 9CD182 GPR9Mig-R Interferon-inducible protein 10 receptor IP10 receptor IP10-R Mig receptor MigR; chemokine (C-X-C motif) receptor 3; chemokine receptor 3; CKR-L2; CXC-R3; G protein-coupled receptor 9; Interferon-inducible protein 10 receptor; IP-10 receptor; Mig receptor
Gene Aliases: CD182; CD183; CKR-L2; CMKAR3; CXCR3; GPR9; IP10-R; Mig-R; MigR
UniProt ID: (Human) P49682
Entrez Gene ID: (Human) 2833
Molecular Function:
G-protein coupled receptor
cell adhesion molecule
cytokine receptor
defense/immunity protein
hydrolase
immunoglobulin receptor superfamily
immunoglobulin superfamily cell adhesion molecule
phosphatase
protein phosphatase
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.