Novus Biologicals
Manufacturer Code:NBP238195
Catalog # NBP238195
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C-X-C chemokine receptor type 2; CD182; CD182 antigen CDw128b chemokine (C-X-C motif) receptor 2 chemokine (CXC) receptor 2 C-X-C chemokine receptor type 2 CXC-R2 CXCR-2 CXCR2 gene for IL8 receptor type B GRO/MGSA receptor High affinity interleukin-8 receptor B IL-8 receptor type 2 IL-8R B IL8R2 IL8RA interleukin 8 receptor B interleukin 8 receptor type 2 interleukin-8 receptor type B; CDw128b; chemokine (C-X-C motif) receptor 2; chemokine (CXC) receptor 2; CXC-R2; CXCR-2; CXCR2 gene for IL8 receptor type B; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8 receptor type 2; IL-8R B; interleukin 8 receptor B; interleukin 8 receptor type 2; interleukin 8 receptor, beta; interleukin-8 receptor type B
Gene Aliases: CD182; CDw128b; CMKAR2; CXCR2; IL8R2; IL8RA; IL8RB
UniProt ID: (Human) P25025
Entrez Gene ID: (Human) 3579
Molecular Function:
G-protein coupled receptor
cell adhesion molecule
cytokine receptor
defense/immunity protein
hydrolase
immunoglobulin receptor superfamily
immunoglobulin superfamily cell adhesion molecule
phosphatase
protein phosphatase
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.