Novus Biologicals
Manufacturer Code:NBP157432
Catalog # NBP157432
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CUGBP1(CUG triplet repeat RNA binding protein 1) The peptide sequence was selected from the N terminal of CUGBP1. Peptide sequence AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 50 kDa nuclear polyadenylated RNA-binding protein; bruno-like 2; Bruno-like protein 2; BRUNOL250 kDa nuclear polyadenylated RNA-binding protein bruno-like 2 Bruno-like protein 2 CUG RNA-binding protein CUG triplet repeat RNA binding protein 1 CUG triplet repeat RNA-binding protein 1 CUG-BP CUG-BP- and ETR-3-like factor 1 CUGBP Elav-like family member 1 CUGBP Elav-like family member 1 CUGBP1CUG triplet repeat RNA-binding protein 1 CUGBPCELF-1 Deadenylation factor CUG-BP EDEN-BP EDEN-BP homolog embryo deadenylation element binding protein Embryo deadenylation element-binding protein homolog hNab50 NAB50CUG-BP1 NAPOR nuclear polyadenylated RNA-binding protein 50-kD RNA-binding protein BRUNOL-2; CELF-1; CUG RNA-binding protein; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; CUG-BP- and ETR-3-like factor 1; CUG-BP1; CUGBP Elav-like family member 1; Deadenylation factor CUG-BP; EDEN-BP homolog; embryo deadenylation element binding protein; Embryo deadenylation element-binding protein homolog; nuclear polyadenylated RNA-binding protein, 50-kD; RNA-binding protein BRUNOL-2
Gene Aliases: BRUNOL2; CELF1; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR
UniProt ID: (Human) Q92879
Entrez Gene ID: (Human) 10658
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.