Novus Biologicals
Manufacturer Code:NBP198466
Catalog # NBP198466
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Cthrc1 - C-terminal region. Peptide sequence HRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEEL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: collagen triple helix repeat containing 1 collagen triple helix repeat-containing protein 1 Protein NMTC1; Collagen triple helix repeat-containing protein 1
Gene Aliases: CTHRC1; UNQ762/PRO1550
UniProt ID: (Human) Q96CG8
Entrez Gene ID: (Human) 115908
Molecular Function: oxidoreductase oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.