Novus Biologicals
Manufacturer Code:NBP257876
Catalog # NBP257876
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADA2A-containing complex subunit 2; ADA2A-containing complex subunit 2 ATAC component 2 homolog ATAC2CRP2BPKAT14 CRP2 binding partner CRP2 binding protein CRP2-binding partner CSRP2 binding protein CSRP2-binding protein cysteine rich protein 2 binding protein cysteine-rich protein 2-binding protein dJ717M23.1 MGC15388 PRO1194; ATAC component 2 homolog; ATAC2; CRP2 binding partner; CRP2 binding protein; CRP2-binding partner; CRP2BP; CSRP2 binding protein; CSRP2-binding protein; Cysteine-rich protein 2-binding protein; Lysine acetyltransferase 14
Gene Aliases: ATAC2; CRP2BP; CSRP2BP; dJ717M23.1; KAT14; PRO1194
UniProt ID: (Human) Q9H8E8
Entrez Gene ID: (Human) 57325
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.