Novus Biologicals
Manufacturer Code:NBP181851
Catalog # NBP181851
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLNVGARAWDKGEVLM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta 4 GalNAcT-2; Beta4GalNAcT-2; beta4GalNAcT-2 CHGN2 chondroitin beta14 N-acetylgalactosaminyltransferase 2 Chondroitin beta-14-N-acetylgalactosaminyltransferase 2 chondroitin sulfate GalNAcT-2 chondroitin sulfate N-acetylgalactosaminyltransferase 2 DKFZp686H13226 EC 2.4.1.174 FLJ43310 GALNACT-2 GALNACT2beta 4 GalNAcT-2 MGC40204 PRO0082; Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 2; chondroitin beta1,4 N-acetylgalactosaminyltransferase 2; Chondroitin sulfate N-acetylgalactosaminyltransferase 2; glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase 2
Gene Aliases: beta4GalNAcT; ChGn-2; CHGN2; CSGALNACT2; GALNACT-2; GALNACT2; PRO0082
UniProt ID: (Human) Q8N6G5
Entrez Gene ID: (Human) 55454
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.