Novus Biologicals
Manufacturer Code:NBP238383
Catalog # NBP238383
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNPSVNWKHKDAA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CASMGC117283 Cellular apoptosis susceptibility protein chromosome segregation 1 (yeast homolog)-like Chromosome segregation 1-like protein CSE1 CSE1 chromosome segregation 1-like (yeast) CSE1L Exp2 exportin-2 Importin-alpha re-exporter MGC130037 XPO2MGC130036; Cellular apoptosis susceptibility protein; Chromosome segregation 1-like protein; CSE1 chromosome segregation 1 like; CSE1 chromosome segregation 1-like; Exp2; Exportin-2; Importin-alpha re-exporter
Gene Aliases: CAS; CSE1; CSE1L; XPO2
UniProt ID: (Human) P55060
Entrez Gene ID: (Human) 1434
Molecular Function: G-protein enzyme modulator small GTPase transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.