Novus Biologicals
Manufacturer Code:NBP184373
Catalog # NBP184373
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Aspartate 1-decarboxylase; CSDMGC119355 cysteine sulfinic acid decarboxylase Cysteine-sulfinate decarboxylase EC 4.1.1 EC 4.1.1.29 FLJ44987 FLJ45500 MGC119354 MGC119357 PCAP P-selectin cytoplasmic tail-associated protein Sulfinoalanine decarboxylase; Cysteine sulfinic acid decarboxylase; cysteine sulfinic acid decarboxylase-related protein; Cysteine-sulfinate decarboxylase; P-selectin cytoplasmic tail-associated protein; Sulfinoalanine decarboxylase
Gene Aliases: CSAD; CSD; PCAP
UniProt ID: (Human) Q9Y600
Entrez Gene ID: (Human) 51380
Molecular Function: decarboxylase lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.