Novus Biologicals
Manufacturer Code:NBP169080
Catalog # NBP169080
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CRY1 (cryptochrome 1 (photolyase-like)) The peptide sequence was selected from the N terminal of CRY1 (NP_004066) Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cryptochrome 1 (photolyase-like); cryptochrome 1 (photolyase-like) PHLL1cryptochrome-1 photolyase-like cryptochrome 1; Cryptochrome-1
Gene Aliases: CRY1; PHLL1
UniProt ID: (Human) Q16526
Entrez Gene ID: (Human) 1407
Molecular Function:
DNA binding protein
DNA photolyase
lyase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.