Novus Biologicals
Manufacturer Code:NBP185606
Catalog # NBP185606
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CISS1 CISScytokine type 1 receptor CRLP-1 CLF CLF-1class I cytokine receptor cytokine receptor-like factor 1 Cytokine-like factor 1 NR6 ZcytoR5; class I cytokine receptor; CLF-1; Cytokine receptor-like factor 1; cytokine type 1 receptor CRLP-1; Cytokine-like factor 1; ZcytoR5
Gene Aliases: CISS; CISS1; CLF; CLF-1; CRLF1; NR6; UNQ288/PRO327; zcytor5
UniProt ID: (Human) O75462
Entrez Gene ID: (Human) 9244
Molecular Function:
cytokine
defense/immunity protein
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.