Novus Biologicals
Manufacturer Code:NBP213875
Catalog # NBP213875
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLH YR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: corticotropin releasing hormone receptor 2 corticotropin-releasing factor receptor 2 Corticotropin-releasing hormone receptor 2 CRF2 CRF2R CRFR2 CRF-R2 CRF-R-2 CRFR-2 CRH2R CRH-R2 CRH-R-2; Corticotropin-releasing factor receptor 2; Corticotropin-releasing hormone receptor 2; CRF-R-2; CRF2 receptor, beta isoform; CRH receptor 2 variant B; CRH-R-2; CRH-R2
Gene Aliases: CRF-RB; CRF2; CRF2R; CRFR2; CRH2R; CRHR2; HM-CRF
UniProt ID: (Human) Q13324
Entrez Gene ID: (Human) 1395
Molecular Function: G-protein coupled receptor antibacterial response protein defense/immunity protein receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.