Novus Biologicals
Manufacturer Code:NBP258065
Catalog # NBP258065
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cellular retinaldehyde-binding protein; Cellular retinaldehyde-binding protein cellular retinaldehyde-binding protein-1 CRALBPretinaldehyde-binding protein 1 MGC3663 retinaldehyde binding protein 1; cellular retinaldehyde-binding protein-1; Retinaldehyde-binding protein 1
Gene Aliases: CRALBP; RLBP1
UniProt ID: (Human) P12271
Entrez Gene ID: (Human) 6017
Molecular Function: dehydrogenase oxidoreductase transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.