Novus Biologicals
Manufacturer Code:NBP159608
Catalog # NBP159608
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CPT1A(carnitine palmitoyltransferase 1A (liver)) The peptide sequence was selected from the middle region of CPT1A (NP_001027017). Peptide sequence LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: carnitine O-palmitoyltransferase 1 liver isoform Carnitine O-palmitoyltransferase I liver isoform Carnitine palmitoyltransferase 1A carnitine palmitoyltransferase 1A (liver) carnitine palmitoyltransferase I liver CPT I CPT1 CPT1-LEC 2.3.1.21 CPTI-L EC 2.3.1 L-CPT1; Carnitine O-palmitoyltransferase 1, liver isoform; Carnitine O-palmitoyltransferase I, liver isoform; Carnitine palmitoyltransferase 1A; carnitine palmitoyltransferase 1A (liver); carnitine palmitoyltransferase I, liver; CPT I; CPT1-L; CPTI-L
Gene Aliases: CPT1; CPT1-L; CPT1A; L-CPT1
UniProt ID: (Human) P50416
Entrez Gene ID: (Human) 1374
Molecular Function:
acetyltransferase
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.