Novus Biologicals
Manufacturer Code:NBP185476
Catalog # NBP185476
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cleavage and polyadenylation specific factor 3 73kD subunit cleavage and polyadenylation specific factor 3 73kDa cleavage and polyadenylation specificity factor 3 Cleavage and polyadenylation specificity factor 73 kDa subunit cleavage and polyadenylation specificity factor subunit 3 CPSF 73 kDa subunit CPSF-73 CPSF73CPSF EC 3.1.27 EC 3.1.27.- mRNA 3'-end-processing endonuclease CPSF-73 YSH1; cleavage and polyadenylation specific factor 3, 73kDa; Cleavage and polyadenylation specificity factor 73 kDa subunit; Cleavage and polyadenylation specificity factor subunit 3; CPSF 73 kDa subunit; mRNA 3'-end-processing endonuclease CPSF-73
Gene Aliases: CPSF-73; CPSF3; CPSF73
UniProt ID: (Human) Q9UKF6
Entrez Gene ID: (Human) 51692
Molecular Function: RNA binding protein endoribonuclease mRNA polyadenylation factor mRNA processing factor nuclease nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.