Novus Biologicals
Manufacturer Code:NBP157114
Catalog # NBP157114
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CPSF4(cleavage and polyadenylation specific factor 4 30kDa) The peptide sequence was selected from the C terminal of CPSF4. Peptide sequence SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 30kD cleavage and polyadenylation specific factor 4 30kD subunit cleavage and polyadenylation specific factor 4 30kDa CPSF 30 kDa subunit Neb-1 No arches homolog no arches-like zinc finger protein NS1 effector domain-binding protein 1; cleavage and polyadenylation specific factor 4, 30kDa; Cleavage and polyadenylation specificity factor 30 kDa subunit; Cleavage and polyadenylation specificity factor subunit 4; CPSF 30 kDa subunit; Neb-1; No arches homolog; no arches-like zinc finger protein; NS1 effector domain-binding protein 1
Gene Aliases: CPSF30; CPSF4; NAR; NEB-1; NEB1
UniProt ID: (Human) O95639
Entrez Gene ID: (Human) 10898
Molecular Function: RNA binding protein endoribonuclease nuclease nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.