Novus Biologicals
Manufacturer Code:NBP157960
Catalog # NBP157960
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CPN1(carboxypeptidase N polypeptide 1) The peptide sequence was selected from the middle region of CPN1. Peptide sequence FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACBP Anaphylatoxin inactivator Arginine carboxypeptidase Carboxypeptidase N polypeptide 1 carboxypeptidase N polypeptide 1 50 kD Carboxypeptidase N small subunit carboxypeptidase N polypeptide 1 carboxypeptidase N polypeptide 1 50kD CPNcarboxypeptidase N catalytic chain EC 3.4.17 EC 3.4.17.3 FLJ40792 kininase I Kininase-1 Lysine carboxypeptidase Plasma carboxypeptidase B SCPNcarboxypeptidase N catalytic subunit Serum carboxypeptidase N; Anaphylatoxin inactivator; Arginine carboxypeptidase; carboxypeptidase K; Carboxypeptidase N catalytic chain; carboxypeptidase N catalytic subunit; Carboxypeptidase N polypeptide 1; carboxypeptidase N polypeptide 1 50 kD; Carboxypeptidase N small subunit; carboxypeptidase N, polypeptide 1; CPN; kininase I; Kininase-1; Lysine carboxypeptidase; Plasma carboxypeptidase B; SCPN; Serum carboxypeptidase N
Gene Aliases: ACBP; CPN; CPN1; SCPN
UniProt ID: (Human) P15169
Entrez Gene ID: (Human) 1369
Molecular Function:
hydrolase
metalloprotease
protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.