Novus Biologicals
Manufacturer Code:NBP157416
Catalog # NBP157416
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the N terminal of CPEB2. Peptide sequence FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CPE-binding protein 2; CPE-BP2; CPEB-2 CPE-binding protein 2 CPE-BP2 cytoplasmic polyadenylation element binding protein 2 cytoplasmic polyadenylation element-binding protein 2 hCPEB-2 MGC119575 MGC119576 MGC119577; Cytoplasmic polyadenylation element-binding protein 2
Gene Aliases: CPE-BP2; CPEB-2; CPEB2; hCPEB-2
UniProt ID: (Human) Q3MI90
Entrez Gene ID: (Human) 132864
Molecular Function: RNA binding protein mRNA polyadenylation factor mRNA processing factor nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.