Novus Biologicals
Manufacturer Code:NBP159554
Catalog # NBP159554
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to COX10(COX10 homolog cytochrome c oxidase assembly protein heme A) The peptide sequence was selected from the middle region of COX10. Peptide sequence APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: COX10 (yeast) homolog cytochrome c oxidase assembly protein (heme A:farnesyltransferase) COX10 homolog cytochrome c oxidase assembly protein heme A:farnesyltransferase (yeast) cytochrome c oxidase assembly protein cytochrome c oxidase subunit X EC 2.5.1.- heme A: farnesyltransferase Heme O synthase protoheme IX farnesyltransferase mitochondrial; COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor; COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase; cytochrome c oxidase assembly homolog 10; cytochrome c oxidase assembly protein; cytochrome c oxidase subunit X; heme A: farnesyltransferase; Heme O synthase; Protoheme IX farnesyltransferase, mitochondrial
Gene Aliases: COX10
UniProt ID: (Human) Q12887
Entrez Gene ID: (Human) 1352
Molecular Function: acyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.