Novus Biologicals
Manufacturer Code:NBP16246620UL
Catalog # NBP16246620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PTGS1(prostaglandin-endoperoxide synthase 1) The peptide sequence was selected form the middle region of PTGS1. Peptide sequence GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: COX-1; COX-1 COX1PGG/HS COX3 Cyclooxygenase-1 EC 1.14.99.1 PCOX1 PGH synthase 1 PGHS1 PGHS-1PHS1 PHS 1 prostaglandin G/H synthase 1 prostaglandin G/H synthase and cyclooxygenase Prostaglandin H2 synthase 1 Prostaglandin-endoperoxide synthase 1 prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase) PTGHS; Cyclooxygenase-1; PGH synthase 1; Prostaglandin G/H synthase 1; Prostaglandin H2 synthase 1; Prostaglandin-endoperoxide synthase 1; prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Gene Aliases: COX1; COX3; PCOX1; PES-1; PGG/HS; PGHS-1; PGHS1; PHS1; PTGHS; PTGS1
UniProt ID: (Human) P23219
Entrez Gene ID: (Human) 5742
Molecular Function: oxidoreductase oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.