Novus Biologicals
Manufacturer Code:NBP239084
Catalog # NBP239084
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5-demethoxyubiquinone hydroxylase; 5-demethoxyubiquinone hydroxylase, mitochondrial; CAT5 CLK1 CLK-1 Coenzyme Q biosynthesis protein 7 homolog coenzyme Q 7 (rat yeast) homolog coenzyme Q7 homolog ubiquinone (yeast) COQ7 coenzyme Q 7 homolog ubiquinone placental protein KG-20 Timing protein clk-1 homolog ubiquinone biosynthesis protein COQ7 homolog; coenzyme Q biosynthesis protein 7 homolog; coenzyme Q7 homolog, ubiquinone; COQ7 coenzyme Q, 7 homolog ubiquinone; DMQ hydroxylase; placental protein KG-20; Timing protein clk-1 homolog; Ubiquinone biosynthesis monooxygenase COQ7; ubiquinone biosynthesis protein COQ7 homolog
Gene Aliases: CAT5; CLK-1; CLK1; COQ10D8; COQ7
UniProt ID: (Human) Q99807
Entrez Gene ID: (Human) 10229
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.