Novus Biologicals
Manufacturer Code:NBP213860
Catalog # NBP213860
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKD NLDDMGYIVENDVIMHALTKQLE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CGI-10 coenzyme Q6 homolog (yeast) coenzyme Q6 homolog monooxygenase (S. cerevisiae) coenzyme Q6 homolog monooxygenase (yeast) EC 1.14.13 EC 1.14.13.- ubiquinone biosynthesis monooxygenase COQ6; Coenzyme Q10 monooxygenase 6; coenzyme Q6 homolog, monooxygenase; coenzyme Q6 monooxygenase; Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
Gene Aliases: CGI-10; CGI10; COQ10D6; COQ6
UniProt ID: (Human) Q9Y2Z9
Entrez Gene ID: (Human) 51004
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.