Novus Biologicals
Manufacturer Code:NBP188725
Catalog # NBP188725
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-polyprenyl-6-hydroxyphenol methylase; 2-polyprenyl-6-hydroxyphenyl methylase; 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase; 3-demethylubiquinol 3-O-methyltransferase; 3-demethylubiquinone-10 3-methyltransferase; 3-demethylubiquinone-10 3-methyltransferase bA9819.1 coenzyme Q3 homolog methyltransferase (S. cerevisiae) coenzyme Q3 homolog methyltransferase (yeast) DHHB methyltransferase DHHBMT DHHB-MT DHHB-MTase DHHBMTASE Dihydroxyhexaprenylbenzoate methyltransferase EC 2.1.1 EC 2.1.1.114 EC 2.1.1.64 hexaprenyldihydroxybenzoate methyltransferase mitochondrial34-dihydroxy-5-hexaprenylbenzoate methyltransferase methyltransferase COQ3 UG0215E05; coenzyme Q3 homolog, methyltransferase; coenzyme Q3 methyltransferase; DHHB methyltransferase; DHHB-MT; DHHB-MTase; dihydroxyhexaprenylbenzoate methyltransferase; hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; methyltransferase COQ3; Polyprenyldihydroxybenzoate methyltransferase; Ubiquinone biosynthesis O-methyltransferase, mitochondrial
Gene Aliases: bA9819.1; COQ3; DHHBMT; DHHBMTASE; UG0215E05
UniProt ID: (Human) Q9NZJ6
Entrez Gene ID: (Human) 51805
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.