Novus Biologicals
Manufacturer Code:NBP184407
Catalog # NBP184407
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: COP9 constitutive photomorphogenic homolog subunit 8; COP9 COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) COP9 homolog COP9 signalosome complex subunit 8 CSN8JAB1-containing signalosome subunit 8 hCOP9 MGC1297 MMMEP SGN8MGC43256 Signalosome subunit 8; COP9 homolog; COP9 signalosome complex subunit 8; hCOP9; JAB1-containing signalosome subunit 8; SGN8; signalosome subunit 8
Gene Aliases: COP9; COPS8; CSN8; SGN8
UniProt ID: (Human) Q99627
Entrez Gene ID: (Human) 10920
Molecular Function:
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.