Novus Biologicals
Manufacturer Code:NBP19833820UL
Catalog # NBP19833820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Cnot8 - N-terminal region. Peptide sequence VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CAF1 CAF2 CALIFCAF1-like protein CALIFp CCR4-NOT transcription complex subunit 8 CCR4-NOT transcription complex subunit 8 hCAF1 PGK promoter directed over production POP2CCR4-associated factor 8; CAF1-like protein; Caf1b; CAF2; CALIFp; CCR4-associated factor 8; CCR4-NOT transcription complex subunit 8; CCR4-NOT transcription complex, subunit 8; PGK promoter directed over production
Gene Aliases: CAF1; Caf1b; CALIF; CNOT8; hCAF1; POP2
UniProt ID: (Human) Q9UFF9
Entrez Gene ID: (Human) 9337
Molecular Function: transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.