Novus Biologicals
Manufacturer Code:NBP159423
Catalog # NBP159423
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CNNM4(cyclin M4) The peptide sequence was selected from the middle region of CNNM4. Peptide sequence LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACDP4cyclin-M4 Ancient conserved domain-containing protein 4 cyclin M4 Cyclin-M4 FLJ37746 FLJ42791 KIAA1592ancient conserved domain protein 4 metal transporter CNNM4; ancient conserved domain protein 4; Ancient conserved domain-containing protein 4; cyclin M4; Cyclin-M4; Metal transporter CNNM4
Gene Aliases: ACDP4; CNNM4; KIAA1592
UniProt ID: (Human) Q6P4Q7
Entrez Gene ID: (Human) 26504
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.