Novus Biologicals
Manufacturer Code:NBP15291020UL
Catalog # NBP15291020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CMAS(cytidine monophosphate N-acetylneuraminic acid synthetase) The peptide sequence was selected from the N terminal of CMAS. Peptide sequence GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthase CMP-N-acetylneuraminic acid synthetase CMP-Neu5Ac synthetase CMP-NeuNAc synthase CMP-NeuNAc synthetase cytidine 5'-monophosphate N-acetylneuraminic acid synthetase cytidine monophosphate N-acetylneuraminic acid synthetase EC 2.7.7.43 N-acylneuraminate cytidylyltransferase; CMP-N-acetylneuraminic acid synthetase; CMP-Neu5Ac synthetase; CMP-NeuNAc synthase; CMP-NeuNAc synthetase; CMP-sialic acid synthetase; cytidine 5'-monophosphate N-acetylneuraminic acid synthetase; N-acylneuraminate cytidylyltransferase
Gene Aliases: CMAS; CSS
UniProt ID: (Human) Q8NFW8
Entrez Gene ID: (Human) 55907
Molecular Function:
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.