Novus Biologicals
Manufacturer Code:NBP17050120UL
Catalog # NBP1705020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LOC646951(similar to hCG1786685) The peptide sequence was selected from the middle region of LOC646951. Peptide sequence SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C3orf76 CLRN1 family with sequence similarity 188 member B2 Putative UPF0526 protein B; family with sequence similarity 188, member B2; Putative UPF0526 protein B
Gene Aliases: C3orf76; CLRN1
Entrez Gene ID: (Human) 646951
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.