Novus Biologicals
Manufacturer Code:NBP238222
Catalog # NBP238222
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C-type lectin domain family 3 member B; C-type lectin domain family 3 member B C-type lectin domain family 3 member B DKFZp686H17246 Plasminogen kringle 4-binding protein tetranectin (plasminogen binding protein) TNAtetranectin (plasminogen-binding protein) TNtetranectin; C-type lectin domain family 3, member B; Plasminogen kringle 4-binding protein; Tetranectin; tetranectin (plasminogen-binding protein); TN
Gene Aliases: CLEC3B; TN; TNA
UniProt ID: (Human) P05452
Entrez Gene ID: (Human) 7123
Molecular Function:
extracellular matrix protein
extracellular matrix structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.