Novus Biologicals
Manufacturer Code:NBP189926
Catalog # NBP189926
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B-cell stimulating factor 3; B-cell stimulating factor 3 B-cell stimulatory factor 3 BSF3BSF-3 cardiotrophin-like cytokine factor 1 CISS2 CLCNNT-1 CRLF1 associated cytokine-like factor 1 neurotrophin-1/B-cell stimulating factor-3 NNT1B-cell-stimulating factor 3 Novel neurotrophin-1 NR6; B-cell stimulatory factor 3; B-cell-stimulating factor 3; BSF-3; Cardiotrophin-like cytokine factor 1; CRLF1 associated cytokine-like factor 1; neurotrophin-1/B-cell stimulating factor-3; NNT-1; Novel neurotrophin-1
Gene Aliases: BSF-3; BSF3; CISS2; CLC; CLCF1; NNT-1; NNT1; NR6
UniProt ID: (Human) Q9UBD9
Entrez Gene ID: (Human) 23529
Molecular Function:
cytokine
interleukin superfamily
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.