Novus Biologicals
Manufacturer Code:NBP174084
Catalog # NBP174084
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of ACOT9. Immunizing peptide sequence FLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACATE2 Acyl-CoA thioester hydrolase 9 acyl-CoA thioesterase 9acyl-Coenzyme A thioesterase 2 mitochondrial acyl-coenzyme A thioesterase 9 mitochondrial CGI-16 EC 3.1.2 EC 3.1.2.- EC 3.1.2.15 mitochondrial Acyl-CoA Thioesterase MT-ACT48; Acyl-CoA thioester hydrolase 9; Acyl-CoA thioesterase 9; acyl-Coenzyme A thioesterase 2, mitochondrial; Acyl-coenzyme A thioesterase 9, mitochondrial; mitochondrial Acyl-CoA Thioesterase
Gene Aliases: ACATE2; ACOT9; CGI-16; MT-ACT48; MTACT48
UniProt ID: (Human) Q9Y305
Entrez Gene ID: (Human) 23597
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.