Novus Biologicals
Manufacturer Code:NBP15798220UL
Catalog # NBP15798220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CETP(cholesteryl ester transfer protein plasma) The peptide sequence was selected from the middle region of CETP. Peptide sequence KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BPI fold containing family F; Cholesteryl ester transfer protein; cholesteryl ester transfer protein cholesteryl ester transfer protein plasma HDLCQ10 Lipid transfer protein I; cholesteryl ester transfer protein plasma; cholesteryl ester transfer protein, plasma; Lipid transfer protein I
Gene Aliases: BPIFF; CETP; HDLCQ10
UniProt ID: (Human) P11597
Entrez Gene ID: (Human) 1071
Molecular Function: antibacterial response protein defense/immunity protein transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.