Novus Biologicals
Manufacturer Code:NBP186435
Catalog # NBP186435
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDP-DAG synthase 2; CDP-DAG synthase 2 CDP-DG synthase 2 CDP-DG synthetase 2 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 CDP-diacylglycerol synthase 2 CDP-diglyceride diphosphorylase 2 CDP-diglyceride pyrophosphorylase 2 CDP-diglyceride synthase 2 CDP-diglyceride synthetase 2 CDS 2 CTP:phosphatidate cytidylyltransferase 2 EC 2.7.7 EC 2.7.7.41 FLJ38111 phosphatidate cytidylyltransferase 2; CDP-DG synthase 2; CDP-DG synthetase 2; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2; CDP-diacylglycerol synthase 2; CDP-diglyceride diphosphorylase 2; CDP-diglyceride pyrophosphorylase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDS 2; CTP:phosphatidate cytidylyltransferase 2; Phosphatidate cytidylyltransferase 2
Gene Aliases: CDS2
UniProt ID: (Human) O95674
Entrez Gene ID: (Human) 8760
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.