Novus Biologicals
Manufacturer Code:NBP159495
Catalog # NBP159495
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CDS1(CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1) The peptide sequence was selected from the middle region of CDS1. Peptide sequence VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDP-DAG synthase 1; CDP-DAG synthase 1 CDP-DG synthase 1 CDP-DG synthetase 1 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1 CDP-diacylglycerol synthase 1 CDP-diglyceride pyrophosphorylase 1 CDP-diglyceride synthase 1 CDP-diglyceride synthetase 1 CDS CDS 1 CTP:phosphatidate cytidylyltransferase 1 EC 2.7.7.41 phosphatidate cytidylyltransferase 1; CDP-DG synthase 1; CDP-DG synthetase 1; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1; CDP-diacylglycerol synthase 1; CDP-diglyceride pyrophosphorylase 1; CDP-diglyceride synthase 1; CDP-diglyceride synthetase 1; CDS 1; CTP:phosphatidate cytidylyltransferase 1; Phosphatidate cytidylyltransferase 1
Gene Aliases: CDS; CDS1
UniProt ID: (Human) Q92903
Entrez Gene ID: (Human) 1040
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.