Novus Biologicals
Manufacturer Code:NBP259027
Catalog # NBP259027
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Mouse |
Class | Monoclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Mouse Monoclonal Antibody
For Research Use Only
Protein Aliases: C48 CDK5 activator-binding protein C48 CDK5 regulatory subunit associated protein 2 CDK5 regulatory subunit-associated protein 2 centrosomal protein 215 kDa Centrosome-associated protein 215 Cep215 DKFZp686B1070 DKFZp686D1070 FLJ10867 KIAA1633microcephaly primary autosomal recessive 3 MCPH3; CDK5 activator-binding protein C48; CDK5 regulatory subunit-associated protein 2; centrosomal protein 215 kDa; Centrosome-associated protein 215; centrosomin
Gene Aliases: C48; CDK5RAP2; CEP215; KIAA1633; MCPH3
UniProt ID: (Human) Q96SN8
Entrez Gene ID: (Human) 55755
Molecular Function:
G-protein modulator
actin binding motor protein
actin family cytoskeletal protein
cell junction protein
cytoskeletal protein
enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.