Novus Biologicals
Manufacturer Code:NBP255112
Catalog # NBP255112
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDK5 activator 1; CDK5 activator 1 CDK5P35 CDK5R cyclin-dependent kinase 5 activator 1 Cyclin-dependent kinase 5 regulatory subunit 1 cyclin-dependent kinase 5 regulatory subunit 1 (p35) MGC33831 NCK5A neuronal CDK5 activator p23 p25 p35 p35nck5a regulatory partner for CDK5 kinase tau protein kinase II 23kDa subunit TPKII regulatory subunit; Cyclin-dependent kinase 5 activator 1; Cyclin-dependent kinase 5 activator 1, p25; Cyclin-dependent kinase 5 activator 1, p35; Cyclin-dependent kinase 5 regulatory subunit 1; cyclin-dependent kinase 5, regulatory subunit 1 (p35); neuronal CDK5 activator; p23; p25; p35; regulatory partner for CDK5 kinase; Tau protein kinase II 23 kDa subunit; tau protein kinase II 23kDa subunit; TPKII regulatory subunit
Gene Aliases: CDK5P35; CDK5R; CDK5R1; NCK5A; p23; p25; p35; p35nck5a
UniProt ID: (Human) Q15078
Entrez Gene ID: (Human) 8851
Molecular Function:
enzyme modulator
kinase activator
kinase modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.