Novus Biologicals
Manufacturer Code:NBP232708
Catalog # NBP232708
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDC7 (cell division cycle 7 S. cerevisiae homolog)-like 1 CDC7 cell division cycle 7 (S. cerevisiae) CDC7L1MGC117361 CDC7-related kinase cell division cycle 7 (S. cerevisiae) cell division cycle 7 homolog (S. cerevisiae) cell division cycle 7-like protein 1 cell division cycle 7-related protein kinase EC 2.7.11.1 HsCdc7 Hsk1 huCdc7 MGC126237 MGC126238; CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1; CDC7-related kinase; cell division cycle 7 homolog; cell division cycle 7-like protein 1; Cell division cycle 7-related protein kinase
Gene Aliases: CDC7; CDC7L1; HsCDC7; Hsk1; huCDC7
UniProt ID: (Human) O00311
Entrez Gene ID: (Human) 8317
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.