Novus Biologicals
Manufacturer Code:NBP198409
Catalog # NBP198409
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is CD84 - C-terminal region. Peptide sequence: YDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD84; CD84 antigen (leukocyte antigen); CD84 antigen CD84 antigen (leukocyte antigen) CD84 molecule Cell surface antigen MAX.3 DKFZp781E2378 hCD84 hly9-beta leucocyte differentiation antigen CD84 leukocyte antigen CD84 Leukocyte differentiation antigen CD84 mCD84 Signaling lymphocytic activation molecule 5 SLAM family member 5 SLAMF5LY9B; Cell surface antigen MAX.3; Hly9-beta; leucocyte differentiation antigen CD84; leukocyte antigen CD84; Leukocyte differentiation antigen CD84; Signaling lymphocytic activation molecule 5; SLAM family member 5
Gene Aliases: CD84; hCD84; LY9B; mCD84; SLAMF5
UniProt ID: (Human) Q9UIB8
Entrez Gene ID: (Human) 8832
Molecular Function:
cell adhesion molecule
cytokine receptor
defense/immunity protein
immunoglobulin receptor superfamily
kinase
protein kinase
receptor
signaling molecule
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.