Novus Biologicals
Manufacturer Code:NBP238485
Catalog # NBP238485
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B-cell activation protein; B-cell activation protein BL11CD83 antigen CD83 antigen (activated B lymphocytes immunoglobulin superfamily) CD83 molecule Cell surface protein HB15 cell-surface glycoprotein HB15hCD83; CD83; CD83 antigen; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); Cell surface protein HB15; cell-surface glycoprotein; hCD83
Gene Aliases: BL11; CD83; HB15
UniProt ID: (Human) Q01151
Entrez Gene ID: (Human) 9308
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.