Novus Biologicals
Manufacturer Code:NBP257614
Catalog # NBP257614
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD') |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A14GALTalpha 14-galactosyltransferase (globotriaosylceramide synthase P blood group) A4GALT1 alpha 14-galactosyltransferase Alpha-14-galactosyltransferase Alpha-14-N-acetylglucosaminyltransferase alpha4Gal-T1 CD77 synthase EC 2.4.1.228 Gb3 synthase Gb3S Globotriaosylceramide synthase lactosylceramide 4-alpha-galactosyltransferase P blood group (P one antigen) P(k) P(k) antigen synthase P1 P1/Pk synthase PK UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase; alpha 14-galactosyltransferase; Alpha-1,4-galactosyltransferase; Alpha-1,4-N-acetylglucosaminyltransferase; Alpha4Gal-T1; CD77 synthase; GB3 synthase; Globotriaosylceramide synthase; Lactosylceramide 4-alpha-galactosyltransferase; P blood group (P one antigen); P(k) antigen synthase; P1/Pk synthase; truncated alpha 1,4-galactosyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Gene Aliases: A14GALT; A4GALT; A4GALT1; Gb3S; P(k); P1; P1PK; PK
UniProt ID: (Human) Q9NPC4
Entrez Gene ID: (Human) 53947
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.