Novus Biologicals
Manufacturer Code:NBP189405
Catalog # NBP189405
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 16.3A5 1F5 1F5 antigen 20 kDa homologous restriction factor CD59 antigen CD59 antigen complement regulatory protein CD59 glycoprotein CD59 molecule complement regulatory protein EJ16 EJ30 EJ30 EL32 and G344) EL32 FLJ38134 FLJ92039 G344 HRF20 HRF-20 human leukocyte antigen MIC11 Ly-6-like protein lymphocytic antigen CD59/MEM43 MACIF MAC-inhibitory protein MAC-IP MEM43 MEM43 antigen membrane attack complex (MAC) inhibition factor Membrane attack complex inhibition factor Membrane inhibitor of reactive lysis MGC2354 MIC11MSK21 MIN1 MIN2 MIN3 MIRL p18-20 protectin surface anitgen recognized by monoclonal 16.3A5 T cell-activating protein; 1F5 antigen; 20 kDa homologous restriction factor; CD59; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); CD59 glycoprotein; CD59 molecule, complement regulatory protein; HRF-20; human leukocyte antigen MIC11; Ly-6-like protein; lymphocytic antigen CD59/MEM43; MAC-inhibitory protein; MAC-IP; MACIF; MEM43 antigen; membrane attack complex (MAC) inhibition factor; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MIRL; Protectin; surface anitgen recognized by monoclonal antibody 16.3A5; T cell-activating protein
Gene Aliases: 16.3A5; 1F5; CD59; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20
UniProt ID: (Human) P13987
Entrez Gene ID: (Human) 966
Molecular Function:
membrane-bound signaling molecule
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.