Novus Biologicals
Manufacturer Code:NBP184431
Catalog # NBP184431
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD300 antigen-like family member A; CD300a; CD300a antigen; CD300a antigenCMRF35H9 CD300a molecule CLM-8 CMRF-35H CMRF35-H CMRF35H leukocyte immunoglobulin-like receptor CMRF35-H9 CMRF-35-H9CD300 antigen-like family member A CMRF35HIRp60 CMRF35-like molecule 8 IgSF12 IGSF12NK inhibitory receptor Immunoglobulin superfamily member 12 Inhibitory receptor protein 60 IRC1 IRC1/IRC2 IRC2 Irp60 leukocyte membrane antigen; CLM-8; CMRF-35-H9; CMRF35-H; CMRF35-H9; CMRF35-like molecule 8; CMRF35H leukocyte immunoglobulin-like receptor; IgSF12; Immunoglobulin superfamily member 12; Inhibitory receptor protein 60; IRC1/IRC2; IRp60; leukocyte membrane antigen; NK inhibitory receptor
Gene Aliases: CD300A; CLM-8; CMRF-35-H9; CMRF-35H; CMRF35-H; CMRF35-H9; CMRF35H; CMRF35H9; HSPC083; IGSF12; IRC1; IRC1/IRC2; IRC2; IRp60
UniProt ID: (Human) Q9UGN4
Entrez Gene ID: (Human) 11314
Molecular Function:
cytokine receptor
defense/immunity protein
immunoglobulin receptor superfamily
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.